MYBPH anticorps (N-Term)

N° du produit ABIN634622

Détail du produit anti-MYBPH anticorps

Antigène: MYBPH (Myosin Binding Protein H (MYBPH))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MYBPH est non-conjugé

Application: Western Blotting (WB)

Specificité: MYBPH antibody was raised against the N terminal of MYBPH

Purification: Affinity purified

Immunogène: MYBPH antibody was raised using the N terminal of MYBPH corresponding to a region with amino acids LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MYBPH Blocking Peptide, catalog no. 33R-4913, is also available for use as a blocking control in assays to test for specificity of this MYBPH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYBPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MYBPH

Antigène: MYBPH (Myosin Binding Protein H (MYBPH))

Autre désignation: MYBPH (MYBPH Produits)

Synonymes: anticorps MGC64588, anticorps MYBPH, anticorps MGC143401, anticorps MGC108122, anticorps AI385643, anticorps MyBP-H, anticorps myosin binding protein H S homeolog, anticorps myosin binding protein H, anticorps mybph.S, anticorps MYBPH, anticorps mybph, anticorps Mybph

Sujet: MYBPH binds to myosin, probably involved in interaction with thick myofilaments in the A-band.

Poids moléculaire: 52 kDa (MW of target protein)