PNN anticorps (N-Term)
-
- Antigène Voir toutes PNN Anticorps
- PNN (Pinin, Desmosome Associated Protein (PNN))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PNN est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PNN antibody was raised against the N terminal of PNN
- Purification
- Affinity purified
- Immunogène
- PNN antibody was raised using the N terminal of PNN corresponding to a region with amino acids MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP
- Top Product
- Discover our top product PNN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PNN Blocking Peptide, catalog no. 33R-5794, is also available for use as a blocking control in assays to test for specificity of this PNN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PNN (Pinin, Desmosome Associated Protein (PNN))
- Autre désignation
- PNN (PNN Produits)
- Synonymes
- anticorps DRS, anticorps DRSP, anticorps SDK3, anticorps memA, anticorps wu:fb24d03, anticorps pnn, anticorps MGC88923, anticorps PNN, anticorps AU045199, anticorps D12Ertd512e, anticorps CG8383, anticorps Dmel\\CG8383, anticorps dPnn, anticorps pinin, desmosome associated protein, anticorps pinin, anticorps Pinin, anticorps PNN, anticorps Pnn, anticorps pnn, anticorps LOC100380709
- Sujet
- PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene, the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression.
- Poids moléculaire
- 81 kDa (MW of target protein)
-