HAPLN1 anticorps (N-Term)
-
- Antigène Voir toutes HAPLN1 Anticorps
- HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HAPLN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HAPLN1 antibody was raised against the N terminal of HAPLN1
- Purification
- Affinity purified
- Immunogène
- HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL
- Top Product
- Discover our top product HAPLN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HAPLN1 Blocking Peptide, catalog no. 33R-2605, is also available for use as a blocking control in assays to test for specificity of this HAPLN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAPLN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HAPLN1 (Hyaluronan and Proteoglycan Link Protein 1 (HAPLN1))
- Autre désignation
- HAPLN1 (HAPLN1 Produits)
- Synonymes
- anticorps crtl1, anticorps hapln1, anticorps wu:fc26f11, anticorps wu:fc37g04, anticorps wu:fc50e12, anticorps wu:fc55h01, anticorps CRTL1, anticorps LP, anticorps BB099155, anticorps CLP, anticorps Crtl1, anticorps Crtl1l, anticorps LP-1, anticorps CTRL1, anticorps hyaluronan and proteoglycan link protein 1, anticorps hyaluronan and proteoglycan link protein 1a, anticorps HAPLN1, anticorps hapln1a, anticorps Hapln1
- Sujet
- HAPLN1 stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the extracellular cartilage matrix.
- Poids moléculaire
- 40 kDa (MW of target protein)
-