Periostin anticorps (N-Term)
-
- Antigène Voir toutes Periostin (POSTN) Anticorps
- Periostin (POSTN)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Periostin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- POSTN antibody was raised against the N terminal of POSTN
- Purification
- Affinity purified
- Immunogène
- POSTN antibody was raised using the N terminal of POSTN corresponding to a region with amino acids RAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
- Top Product
- Discover our top product POSTN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
POSTN Blocking Peptide, catalog no. 33R-7797, is also available for use as a blocking control in assays to test for specificity of this POSTN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POSTN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Periostin (POSTN)
- Autre désignation
- POSTN (POSTN Produits)
- Synonymes
- anticorps fa99h07, anticorps pn, anticorps postn, anticorps wu:fa99h07, anticorps wu:fc70f09, anticorps zgc:153873, anticorps LOC100008945, anticorps osf-2, anticorps pdlpostn, anticorps periostin, anticorps OSF-2, anticorps OSF2, anticorps PDLPOSTN, anticorps PN, anticorps RP11-412K4.1, anticorps A630052E07Rik, anticorps AI747096, anticorps Osf2, anticorps PLF, anticorps peri, anticorps Plf, anticorps periostin, anticorps periostin, osteoblast specific factor b, anticorps periostin, osteoblast specific factor, anticorps POSTN, anticorps postnb, anticorps postn, anticorps Postn
- Sujet
- POSTN binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.
- Poids moléculaire
- 93 kDa (MW of target protein)
-