Osteomodulin anticorps (Middle Region)
-
- Antigène Voir toutes Osteomodulin (OMD) Anticorps
- Osteomodulin (OMD)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Osteomodulin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Osteomodulin antibody was raised against the middle region of OMD
- Purification
- Affinity purified
- Immunogène
- Osteomodulin antibody was raised using the middle region of OMD corresponding to a region with amino acids LLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLD
- Top Product
- Discover our top product OMD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Osteomodulin Blocking Peptide, catalog no. 33R-5180, is also available for use as a blocking control in assays to test for specificity of this Osteomodulin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Osteomodulin (OMD)
- Autre désignation
- Osteomodulin (OMD Produits)
- Synonymes
- anticorps si:ch211-103f16.5, anticorps OMD, anticorps OSAD, anticorps SLRR2C, anticorps osteomodulin, anticorps omd, anticorps OMD, anticorps Omd
- Sujet
- OMD may be implicated in biomineralization processes. Has a function in binding of osteoblasts via the alpha(V)beta(3)-integrin.
- Poids moléculaire
- 49 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-