Laminin beta 3 anticorps (Middle Region)
-
- Antigène Voir toutes Laminin beta 3 (LAMB3) Anticorps
- Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Laminin beta 3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Laminin Beta 3 antibody was raised against the middle region of LAMB3
- Purification
- Affinity purified
- Immunogène
- Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD
- Top Product
- Discover our top product LAMB3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Laminin Beta 3 Blocking Peptide, catalog no. 33R-2696, is also available for use as a blocking control in assays to test for specificity of this Laminin Beta 3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAMB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Laminin beta 3 (LAMB3) (Laminin, beta 3 (LAMB3))
- Autre désignation
- Laminin beta 3 (LAMB3 Produits)
- Synonymes
- anticorps LAMB3, anticorps lam5, anticorps lamnb1, anticorps BM600-125KDA, anticorps LAM5, anticorps LAMNB1, anticorps laminin subunit beta 3, anticorps laminin, beta 3, anticorps LAMB3, anticorps lamb3, anticorps Lamb3
- Sujet
- The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5.
- Poids moléculaire
- 128 kDa (MW of target protein)
- Pathways
- Brown Fat Cell Differentiation
-