PPP2R1B anticorps
-
- Antigène Voir toutes PPP2R1B Anticorps
- PPP2R1B (Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP2R1B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PPP2 R2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ
- Top Product
- Discover our top product PPP2R1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP2R1B Blocking Peptide, catalog no. 33R-2332, is also available for use as a blocking control in assays to test for specificity of this PPP2R1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP2R1B (Protein Phosphatase 2, Regulatory Subunit A, beta (PPP2R1B))
- Autre désignation
- PPP2R1B (PPP2R1B Produits)
- Synonymes
- anticorps 2410091N08Rik, anticorps AI790395, anticorps PP2A-Abeta, anticorps PR65B, anticorps protein phosphatase 2, regulatory subunit A, beta, anticorps protein phosphatase 2 scaffold subunit Abeta, anticorps protein phosphatase 2 scaffold subunit A beta, anticorps protein phosphatase 2 regulatory subunit A, beta S homeolog, anticorps Ppp2r1b, anticorps PPP2R1B, anticorps ppp2r1b.S
- Sujet
- This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division.
- Poids moléculaire
- 73 kDa (MW of target protein)
- Pathways
- Signalisation PI3K-Akt, Mitotic G1-G1/S Phases, Hepatitis C, Toll-Like Receptors Cascades
-