AZGP1 anticorps (N-Term)
-
- Antigène Voir toutes AZGP1 Anticorps
- AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp AZGP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- AZGP1 antibody was raised against the N terminal of AZGP1
- Purification
- Affinity purified
- Immunogène
- AZGP1 antibody was raised using the N terminal of AZGP1 corresponding to a region with amino acids KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN
- Top Product
- Discover our top product AZGP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
AZGP1 Blocking Peptide, catalog no. 33R-4700, is also available for use as a blocking control in assays to test for specificity of this AZGP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AZGP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- AZGP1 (alpha-2-Glycoprotein 1, Zinc-Binding (AZGP1))
- Autre désignation
- AZGP1 (AZGP1 Produits)
- Synonymes
- anticorps Zag, anticorps ZA2G, anticorps ZAG, anticorps ZA2GA, anticorps Zna2gp, anticorps alpha-2-glycoprotein 1, zinc, anticorps alpha-2-glycoprotein 1, zinc-binding, anticorps Azgp1, anticorps AZGP1
- Sujet
- Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.
- Poids moléculaire
- 33 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-