Connexin 43/GJA1 anticorps (N-Term)

N° du produit ABIN634661

Détail du produit anti-Connexin 43/GJA1 anticorps

Antigène: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Connexin 43/GJA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJA1 antibody was raised against the N terminal of GJA1

Purification: Affinity purified

Immunogène: GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJA1 Blocking Peptide, catalog no. 33R-5566, is also available for use as a blocking control in assays to test for specificity of this GJA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Connexin 43/GJA1

Antigène: Connexin 43/GJA1 (GJA1) (Gap Junction Protein, alpha 1, 43kDa (GJA1))

Autre désignation: GJA1 (GJA1 Produits)

Synonymes: anticorps AVSD3, anticorps CX43, anticorps DFNB38, anticorps GJAL, anticorps HLHS1, anticorps HSS, anticorps ODDD, anticorps Cx43, anticorps AU042049, anticorps AW546267, anticorps Cnx43, anticorps Cx43alpha1, anticorps Gja-1, anticorps Npm1, anticorps connexin43, anticorps cx43a1, anticorps gja1, anticorps zfCx43.3, anticorps connexin 43, anticorps gja1-A, anticorps cx43, anticorps gjal, anticorps oddd, anticorps dfnb38, anticorps gap junction protein alpha 1, anticorps gap junction protein, alpha 1, anticorps connexin 43, anticorps gap junction protein alpha 1 L homeolog, anticorps CONNEXIN 43 protein, anticorps GJA1, anticorps Gja1, anticorps cx43, anticorps gja1.L, anticorps gja1, anticorps CONNEXIN 43

Sujet: Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Signalisation MAPK, Myometrial Relaxation and Contraction, Cell-Cell Junction Organization