MICA anticorps (N-Term)
-
- Antigène Voir toutes MICA Anticorps
- MICA (MHC Class I Polypeptide-Related Sequence A (MICA))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MICA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MICA antibody was raised against the N terminal of MICA
- Purification
- Affinity purified
- Immunogène
- MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ
- Top Product
- Discover our top product MICA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MICA Blocking Peptide, catalog no. 33R-5029, is also available for use as a blocking control in assays to test for specificity of this MICA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MICA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MICA (MHC Class I Polypeptide-Related Sequence A (MICA))
- Autre désignation
- MICA (MICA Produits)
- Synonymes
- anticorps MIC-A, anticorps PERB11.1, anticorps MHC class I polypeptide-related sequence A, anticorps MICA
- Sujet
- MICA is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognised by intestinal epithelial gamma delta T cells.
- Poids moléculaire
- 43 kDa (MW of target protein)
- Pathways
- Activation of Innate immune Response, Transition Metal Ion Homeostasis, Human Leukocyte Antigen (HLA) in Adaptive Immune Response
-