Osteopontin anticorps

N° du produit ABIN634668

Détail du produit anti-Osteopontin anticorps

Antigène: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Osteopontin est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPP1 Blocking Peptide, catalog no. 33R-6363, is also available for use as a blocking control in assays to test for specificity of this SPP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Osteopontin

Antigène: Osteopontin (SPP1) (Secreted phosphoprotein 1 (SPP1))

Autre désignation: SPP1 (SPP1 Produits)

Synonymes: anticorps BNSP, anticorps BSPI, anticorps ETA-1, anticorps OPN, anticorps 2AR, anticorps Apl-1, anticorps Bsp, anticorps Eta, anticorps OP, anticorps Opn, anticorps Opnl, anticorps Ric, anticorps Spp-1, anticorps OSP, anticorps zgc:111821, anticorps secreted phosphoprotein 1, anticorps SPP1, anticorps Spp1, anticorps spp1

Sujet: The SPP1 gene encodes an acidic matrix protein, mainly expressed in mineralized tissues, kidney and atherosclerotic vessels. This protein also contributes to several steps in the process of prostate carcinogenesis and metastasis.

Poids moléculaire: 34 kDa (MW of target protein)

Pathways: Regulation of Cell Size