KIT Ligand anticorps (Middle Region)
-
- Antigène Voir toutes KIT Ligand (KITLG) Anticorps
- KIT Ligand (KITLG)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KIT Ligand est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- KITLG antibody was raised against the middle region of KITLG
- Purification
- Affinity purified
- Immunogène
- KITLG antibody was raised using the middle region of KITLG corresponding to a region with amino acids TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG
- Top Product
- Discover our top product KITLG Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
KITLG Blocking Peptide, catalog no. 33R-9145, is also available for use as a blocking control in assays to test for specificity of this KITLG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KITLG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- KIT Ligand (KITLG)
- Autre désignation
- KITLG (KITLG Produits)
- Sujet
- KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT locus. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis.
- Poids moléculaire
- 28 kDa (MW of target protein)
- Pathways
- Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway
-