CD36 anticorps
-
- Antigène Voir toutes CD36 Anticorps
- CD36
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CD36 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CD36 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQV
- Top Product
- Discover our top product CD36 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CD36 Blocking Peptide, catalog no. 33R-4679, is also available for use as a blocking control in assays to test for specificity of this CD36 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD36 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CD36
- Autre désignation
- CD36 (CD36 Produits)
- Synonymes
- anticorps BDPLT10, anticorps CHDS7, anticorps FAT, anticorps GP3B, anticorps GP4, anticorps GPIV, anticorps PASIV, anticorps SCARB3, anticorps Fat, anticorps Scarb3, anticorps GPIIIB, anticorps PAS-4, anticorps zgc:92513, anticorps CD36 molecule, anticorps CD36 molecule (thrombospondin receptor), anticorps CD36, anticorps Cd36, anticorps cd36
- Sujet
- CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Signalisation TLR, Peptide Hormone Metabolism, Response to Growth Hormone Stimulus, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Hepatitis C, Toll-Like Receptors Cascades, Lipid Metabolism, S100 Proteins
-