Astrotactin 2 anticorps (N-Term)

N° du produit ABIN634672

Détail du produit anti-Astrotactin 2 anticorps

Antigène: Astrotactin 2 (ASTN2)

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Astrotactin 2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Astrotactin 2 antibody was raised against the N terminal of ASTN2

Purification: Affinity purified

Immunogène: Astrotactin 2 antibody was raised using the N terminal of ASTN2 corresponding to a region with amino acids PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Astrotactin 2 Blocking Peptide, catalog no. 33R-7131, is also available for use as a blocking control in assays to test for specificity of this Astrotactin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASTN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Astrotactin 2

Antigène: Astrotactin 2 (ASTN2)

Autre désignation: Astrotactin 2 (ASTN2 Produits)

Synonymes: anticorps bA67K19.1, anticorps ASTN2, anticorps 1d8, anticorps Astnl, anticorps bM452J22.1, anticorps astrotactin 2, anticorps astrotactin-2, anticorps ASTN2, anticorps LOC702370, anticorps astn2, anticorps Astn2

Sujet: ASTN2 may play an important role in neuronal functioning.

Poids moléculaire: 142 kDa (MW of target protein)