GJA3 anticorps (N-Term)

N° du produit ABIN634674

Détail du produit anti-GJA3 anticorps

Antigène: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GJA3 est non-conjugé

Application: Western Blotting (WB)

Specificité: GJA3 antibody was raised against the N terminal of GJA3

Purification: Affinity purified

Immunogène: GJA3 antibody was raised using the N terminal of GJA3 corresponding to a region with amino acids ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GJA3 Blocking Peptide, catalog no. 33R-4153, is also available for use as a blocking control in assays to test for specificity of this GJA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GJA3

Antigène: GJA3 (Gap Junction Protein, alpha 3, 46kDa (GJA3))

Autre désignation: GJA3 (GJA3 Produits)

Synonymes: anticorps cx46, anticorps MGC53082, anticorps czp3, anticorps Cx44, anticorps cx48.5, anticorps Cnx46, anticorps Cx43, anticorps Cx46, anticorps Gja-3, anticorps CTRCT14, anticorps CX46, anticorps CZP3, anticorps MGC69466 protein L homeolog, anticorps gap junction protein alpha 3, anticorps gap junction protein, alpha 3, anticorps MGC69466.L, anticorps gja3, anticorps GJA3, anticorps Gja3

Sujet: GJA3 belongs to the connexin family. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in GJA3 are the cause of zonular pulverulent cataract type 3 (CZP3).

Poids moléculaire: 47 kDa (MW of target protein)