Desmoglein 2 anticorps (N-Term)
-
- Antigène Voir toutes Desmoglein 2 (DSG2) Anticorps
- Desmoglein 2 (DSG2)
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Desmoglein 2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Desmoglein 2 antibody was raised against the N terminal of DSG2
- Purification
- Affinity purified
- Immunogène
- Desmoglein 2 antibody was raised using the N terminal of DSG2 corresponding to a region with amino acids KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSILDREE
- Top Product
- Discover our top product DSG2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Desmoglein 2 Blocking Peptide, catalog no. 33R-4430, is also available for use as a blocking control in assays to test for specificity of this Desmoglein 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSG2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Desmoglein 2 (DSG2)
- Autre désignation
- Desmoglein 2 (DSG2 Produits)
- Synonymes
- anticorps DSG2, anticorps dsc, anticorps dsga, anticorps si:dkeyp-51f12.6, anticorps wu:fj23f02, anticorps ARVC10, anticorps ARVD10, anticorps CDHF5, anticorps CMD1BB, anticorps HDGC, anticorps AA408168, anticorps D18Ertd293e, anticorps desmoglein 2, anticorps desmoglein 2, tandem duplicate 1, anticorps DSG2, anticorps dsg2.1, anticorps dsg2, anticorps Dsg2
- Sujet
- Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. DSG2 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This second family member is expressed in colon, colon carcinoma, and other simple and stratified epithelial-derived cell lines.
- Poids moléculaire
- 114 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-