ROM1 anticorps (Middle Region)
-
- Antigène Voir toutes ROM1 Anticorps
- ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ROM1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ROM1 antibody was raised against the middle region of ROM1
- Purification
- Affinity purified
- Immunogène
- ROM1 antibody was raised using the middle region of ROM1 corresponding to a region with amino acids NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT
- Top Product
- Discover our top product ROM1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ROM1 Blocking Peptide, catalog no. 33R-6819, is also available for use as a blocking control in assays to test for specificity of this ROM1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ROM1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ROM1 (Retinal Outer Segment Membrane Protein 1 (ROM1))
- Autre désignation
- ROM1 (ROM1 Produits)
- Synonymes
- anticorps ROM, anticorps ROSP1, anticorps RP7, anticorps TSPAN23, anticorps ROM1, anticorps M101156, anticorps Rgsc1156, anticorps Rom-1, anticorps Rosp1, anticorps Tspan23, anticorps rds35, anticorps rom, anticorps rosp1, anticorps tspan23, anticorps Rds, anticorps zgc:56548, anticorps zgc:73336, anticorps zgc:77401, anticorps retinal outer segment membrane protein 1, anticorps rod outer segment membrane protein 1, anticorps retinal outer segment membrane protein 1 L homeolog, anticorps retinal outer segment membrane protein 1b, anticorps retinal outer segment membrane protein 1a, anticorps ROM1, anticorps Rom1, anticorps rom1.L, anticorps rom1b, anticorps rom1a
- Sujet
- ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.
- Poids moléculaire
- 37 kDa (MW of target protein)
-