Cx40/GJA5 anticorps (N-Term)
-
- Antigène Voir toutes Cx40/GJA5 (GJA5) Anticorps
- Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Cx40/GJA5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GJA5 antibody was raised against the N terminal of GJA5
- Purification
- Affinity purified
- Immunogène
- GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC
- Top Product
- Discover our top product GJA5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GJA5 Blocking Peptide, catalog no. 33R-8882, is also available for use as a blocking control in assays to test for specificity of this GJA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Cx40/GJA5 (GJA5) (Gap Junction Protein, alpha 5, 40kDa (GJA5))
- Autre désignation
- GJA5 (GJA5 Produits)
- Synonymes
- anticorps Cx40, anticorps 5730555N10Rik, anticorps Cnx40, anticorps Gja-5, anticorps ATFB11, anticorps CX40, anticorps gap junction protein, alpha 5, anticorps gap junction protein alpha 5, anticorps Gja5, anticorps GJA5
- Sujet
- GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-