Protocadherin 1 anticorps (N-Term)

N° du produit ABIN634688

Détail du produit anti-Protocadherin 1 anticorps

Antigène: Protocadherin 1 (PCDH1)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Protocadherin 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDH1 antibody was raised against the N terminal of PCDH1

Purification: Affinity purified

Immunogène: PCDH1 antibody was raised using the N terminal of PCDH1 corresponding to a region with amino acids LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDH1 Blocking Peptide, catalog no. 33R-5177, is also available for use as a blocking control in assays to test for specificity of this PCDH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Protocadherin 1

Antigène: Protocadherin 1 (PCDH1)

Autre désignation: PCDH1 (PCDH1 Produits)

Synonymes: anticorps PC42, anticorps PCDH42, anticorps 2010005A06Rik, anticorps AI585920, anticorps PCDH-1, anticorps axpc, anticorps protocadherin-1, anticorps pcdh1, anticorps protocadherin 1, anticorps protocadherin 1 S homeolog, anticorps protocadherin 1b, anticorps PCDH1, anticorps Pcdh1, anticorps pcdh1.S, anticorps pcdh1b

Sujet: PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.

Poids moléculaire: 111 kDa (MW of target protein)