LSAMP anticorps (N-Term)

N° du produit ABIN634691

Détail du produit anti-LSAMP anticorps

Antigène: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LSAMP est non-conjugé

Application: Western Blotting (WB)

Specificité: LSAMP antibody was raised against the N terminal of LSAMP

Purification: Affinity purified

Immunogène: LSAMP antibody was raised using the N terminal of LSAMP corresponding to a region with amino acids MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LSAMP Blocking Peptide, catalog no. 33R-6605, is also available for use as a blocking control in assays to test for specificity of this LSAMP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSAMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LSAMP

Antigène: LSAMP (Limbic System-Associated Membrane Protein (LSAMP))

Autre désignation: LSAMP (LSAMP Produits)

Synonymes: anticorps chLAMP, anticorps IGLON3, anticorps LAMP, anticorps 5430428I19, anticorps AW046674, anticorps B130007O04Rik, anticorps D930023J12Rik, anticorps Lam, anticorps Lamp, anticorps limbic system-associated membrane protein, anticorps LSAMP, anticorps Lsamp

Sujet: LSAMP is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

Poids moléculaire: 37 kDa (MW of target protein)