PCDHAC1 anticorps (N-Term)
-
- Antigène Voir toutes PCDHAC1 Anticorps
- PCDHAC1 (Protocadherin alpha Subfamily C, 1 (PCDHAC1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCDHAC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCDHAC1 antibody was raised against the N terminal of PCDHAC1
- Purification
- Affinity purified
- Immunogène
- PCDHAC1 antibody was raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE
- Top Product
- Discover our top product PCDHAC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCDHAC1 Blocking Peptide, catalog no. 33R-8254, is also available for use as a blocking control in assays to test for specificity of this PCDHAC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHAC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCDHAC1 (Protocadherin alpha Subfamily C, 1 (PCDHAC1))
- Autre désignation
- PCDHAC1 (PCDHAC1 Produits)
- Synonymes
- anticorps PCDH-ALPHA-C1, anticorps CNRc1, anticorps rCNRvc1, anticorps protocadherin alpha subfamily C, 1, anticorps PCDHAC1, anticorps Pcdhac1
- Sujet
- PCDHAC1 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.
- Poids moléculaire
- 87 kDa (MW of target protein)
-