DLL1 anticorps
-
- Antigène Voir toutes DLL1 Anticorps
- DLL1 (delta-Like 1 (DLL1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DLL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DLL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP
- Top Product
- Discover our top product DLL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DLL1 Blocking Peptide, catalog no. 33R-3580, is also available for use as a blocking control in assays to test for specificity of this DLL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DLL1 (delta-Like 1 (DLL1))
- Autre désignation
- DLL1 (DLL1 Produits)
- Synonymes
- anticorps X-delta-1, anticorps XDelta1, anticorps Xdelta-1, anticorps delta, anticorps delta-1, anticorps delta1, anticorps x-delta, anticorps DELTA1, anticorps DL1, anticorps Delta, anticorps DLK, anticorps DLK-1, anticorps Delta1, anticorps FA1, anticorps PREF1, anticorps Pref-1, anticorps ZOG, anticorps pG2, anticorps DLL1, anticorps AW742678, anticorps DlkI, anticorps Ly107, anticorps Peg9, anticorps SCP1, anticorps pref-1, anticorps delta-like 1, anticorps delta like canonical Notch ligand 1, anticorps delta like non-canonical Notch ligand 1, anticorps delta-like 1 L homeolog, anticorps delta-like 1 (Drosophila), anticorps delta-like 1 homolog (Drosophila), anticorps dll1, anticorps DLL1, anticorps DLK1, anticorps Dll1, anticorps dll1.L, anticorps Dlk1
- Sujet
- DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication.
- Poids moléculaire
- 78 kDa (MW of target protein)
- Pathways
- Signalisation Notch, Stem Cell Maintenance
-