CSGALNACT1 anticorps (C-Term)
-
- Antigène Voir toutes CSGALNACT1 Anticorps
- CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CSGALNACT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHGN antibody was raised against the C terminal Of Chgn
- Purification
- Affinity purified
- Immunogène
- CHGN antibody was raised using the C terminal Of Chgn corresponding to a region with amino acids DELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT
- Top Product
- Discover our top product CSGALNACT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHGN Blocking Peptide, catalog no. 33R-1910, is also available for use as a blocking control in assays to test for specificity of this CHGN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CSGALNACT1 (Chondroitin Sulfate N-Acetylgalactosaminyltransferase 1 (CSGALNACT1))
- Autre désignation
- CHGN (CSGALNACT1 Produits)
- Synonymes
- anticorps CSGalNAcT-1, anticorps ChGn, anticorps beta4GalNAcT, anticorps CHGN, anticorps 4732435N03Rik, anticorps Chgn, anticorps RGD1307618, anticorps chondroitin sulfate N-acetylgalactosaminyltransferase 1, anticorps CSGALNACT1, anticorps csgalnact1, anticorps Csgalnact1, anticorps LOC100517735
- Sujet
- ChGn transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). This protein is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains. It play an important role in chondroitin chain biosynthesis in cartilage.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-