CNTNAP4 anticorps (N-Term)

N° du produit ABIN634701

Détail du produit anti-CNTNAP4 anticorps

Antigène: CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNTNAP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: CNTNAP4 antibody was raised against the N terminal of CNTNAP4

Purification: Affinity purified

Immunogène: CNTNAP4 antibody was raised using the N terminal of CNTNAP4 corresponding to a region with amino acids KLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNTNAP4 Blocking Peptide, catalog no. 33R-4529, is also available for use as a blocking control in assays to test for specificity of this CNTNAP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNTNAP4

Antigène: CNTNAP4 (Contactin Associated Protein-Like 4 (CNTNAP4))

Autre désignation: CNTNAP4 (CNTNAP4 Produits)

Synonymes: anticorps CNTNAP4, anticorps CNTNAP5, anticorps cntnap4, anticorps CASPR4, anticorps Caspr4, anticorps E130114F09Rik, anticorps contactin associated protein like 4, anticorps contactin-associated protein-like 3, anticorps contactin-associated protein-like 4, anticorps contactin associated protein like 3, anticorps contactin associated protein-like 4, anticorps CNTNAP4, anticorps LOC100064076, anticorps LOC100472293, anticorps cntnap3, anticorps cntnap4, anticorps Cntnap4

Sujet: CNTNAP4 belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains.

Poids moléculaire: 145 kDa (MW of target protein)