Cadherin 12 anticorps

N° du produit ABIN634703

Détail du produit anti-Cadherin 12 anticorps

Antigène: Cadherin 12

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cadherin 12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids DTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFHSAGPFKDTATVKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH12 Blocking Peptide, catalog no. 33R-2203, is also available for use as a blocking control in assays to test for specificity of this CDH12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cadherin 12

Antigène: Cadherin 12

Autre désignation: CDH12 (Cadherin 12 Produits)

Synonymes: anticorps CDHB, anticorps Cdhb, anticorps RGD1566350, anticorps cdh12, anticorps cadherin 12, anticorps cadherin-12, anticorps CDH12, anticorps Cdh12, anticorps LOC570372

Sujet: CDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

Poids moléculaire: 82 kDa (MW of target protein)