Desmocollin 3 anticorps (N-Term)

N° du produit ABIN634705

Détail du produit anti-Desmocollin 3 anticorps

Antigène: Desmocollin 3 (DSC3)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Desmocollin 3 est non-conjugé

Application: Western Blotting (WB)

Specificité: Desmocollin 3 antibody was raised against the N terminal of DSC3

Purification: Affinity purified

Immunogène: Desmocollin 3 antibody was raised using the N terminal of DSC3 corresponding to a region with amino acids MQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDKEPLNLFYIERDTG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Desmocollin 3 Blocking Peptide, catalog no. 33R-6324, is also available for use as a blocking control in assays to test for specificity of this Desmocollin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DSC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Desmocollin 3

Antigène: Desmocollin 3 (DSC3)

Autre désignation: Desmocollin 3 (DSC3 Produits)

Synonymes: anticorps CDHF3, anticorps DSC, anticorps DSC1, anticorps DSC2, anticorps DSC4, anticorps HT-CP, anticorps 5430426I24Rik, anticorps MGC85083, anticorps desmocollin 3, anticorps desmocollin 3 S homeolog, anticorps DSC3, anticorps Dsc3, anticorps dsc3.S, anticorps dsc3

Sujet: DSC3 is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where they constitute the adhesive proteins of the desmosome cell-cell junction and are required for cell adhesion and desmosome formation.

Poids moléculaire: 85 kDa (MW of target protein)