Cadherin 24 anticorps (N-Term)

N° du produit ABIN634707

Détail du produit anti-Cadherin 24 anticorps

Antigène: Cadherin 24 (CDH24)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cadherin 24 est non-conjugé

Application: Western Blotting (WB)

Specificité: CDH24 antibody was raised against the N terminal of CDH24

Purification: Affinity purified

Immunogène: CDH24 antibody was raised using the N terminal of CDH24 corresponding to a region with amino acids NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CDH24 Blocking Peptide, catalog no. 33R-6825, is also available for use as a blocking control in assays to test for specificity of this CDH24 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cadherin 24

Antigène: Cadherin 24 (CDH24)

Autre désignation: CDH24 (CDH24 Produits)

Synonymes: anticorps CDH11L, anticorps 1700040A22Rik, anticorps ENSMUSG00000022188, anticorps RGD1560161, anticorps cdh24, anticorps cadherin 24, anticorps cadherin-like 24, anticorps cadherin-24, anticorps CDH24, anticorps Cdh24, anticorps LOC100007192

Sujet: Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells, cadherins may thus contribute to the sorting of heterogeneous cell types. Cadherin-24 mediate strong cell-cell adhesion.

Poids moléculaire: 88 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization