MPZL2 anticorps (N-Term)

N° du produit ABIN634708

Détail du produit anti-MPZL2 anticorps

Antigène: MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPZL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MPZL2 antibody was raised against the N terminal of MPZL2

Purification: Affinity purified

Immunogène: MPZL2 antibody was raised using the N terminal of MPZL2 corresponding to a region with amino acids LEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPZL2 Blocking Peptide, catalog no. 33R-4881, is also available for use as a blocking control in assays to test for specificity of this MPZL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPZL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPZL2

Antigène: MPZL2 (Myelin Protein Zero-Like 2 (MPZL2))

Autre désignation: MPZL2 (MPZL2 Produits)

Synonymes: anticorps cb837, anticorps eva1, anticorps mpzl2, anticorps wu:fb07b02, anticorps EVA1, anticorps EVA, anticorps Eva, anticorps Eva1, anticorps myelin protein zero-like 2b, anticorps myelin protein zero like 2, anticorps myelin protein zero-like 2, anticorps mpzl2b, anticorps MPZL2, anticorps Mpzl2

Sujet: Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. This gene is expressed in the thymus and in several epithelial structures early in embryogenesis.

Poids moléculaire: 22 kDa (MW of target protein)