Protocadherin gamma Subfamily C, 3 (PCDHGC3) (N-Term) anticorps
-
- Antigène Voir toutes Protocadherin gamma Subfamily C, 3 (PCDHGC3) Anticorps
- Protocadherin gamma Subfamily C, 3 (PCDHGC3)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Specificité
- PCDHGC3 antibody was raised against the N terminal of PCDHGC3
- Purification
- Affinity purified
- Immunogène
- PCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY
- Top Product
- Discover our top product PCDHGC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCDHGC3 Blocking Peptide, catalog no. 33R-4148, is also available for use as a blocking control in assays to test for specificity of this PCDHGC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Protocadherin gamma Subfamily C, 3 (PCDHGC3)
- Autre désignation
- PCDHGC3 (PCDHGC3 Produits)
- Synonymes
- anticorps PC43, anticorps PCDH-GAMMA-C3, anticorps PCDH2, anticorps Pcdh2, anticorps PCDHGA11, anticorps PCDHGC5, anticorps protocadherin gamma subfamily C, 3, anticorps PCDHGC3, anticorps Pcdhgc3
- Sujet
- This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. PCDHGC3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Poids moléculaire
- 91 kDa (MW of target protein)
-