Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) anticorps

N° du produit ABIN634712

Détail du produit

Antigène: Protocadherin gamma Subfamily A, 4 (PCDHGA4)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: PCDHGA4 antibody was raised against the N terminal of PCDHGA4

Purification: Affinity purified

Immunogène: PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHGA4 Blocking Peptide, catalog no. 33R-3205, is also available for use as a blocking control in assays to test for specificity of this PCDHGA4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Protocadherin gamma Subfamily A, 4 (PCDHGA4)

Autre désignation: PCDHGA4 (PCDHGA4 Produits)

Synonymes: anticorps PCDH-GAMMA-A4, anticorps Pcdhga3, anticorps protocadherin gamma subfamily A, 4, anticorps PCDHGA4, anticorps Pcdhga4

Sujet: PCDHGA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 86 kDa (MW of target protein)