ICAM5 anticorps (N-Term)

N° du produit ABIN634713

Détail du produit anti-ICAM5 anticorps

Antigène: ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ICAM5 est non-conjugé

Application: Western Blotting (WB)

Specificité: ICAM5 antibody was raised against the N terminal of ICAM5

Purification: Affinity purified

Immunogène: ICAM5 antibody was raised using the N terminal of ICAM5 corresponding to a region with amino acids RRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ICAM5 Blocking Peptide, catalog no. 33R-8151, is also available for use as a blocking control in assays to test for specificity of this ICAM5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ICAM5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ICAM5

Antigène: ICAM5 (Intercellular Adhesion Molecule 5 (ICAM5))

Autre désignation: ICAM5 (ICAM5 Produits)

Synonymes: anticorps TLCN, anticorps TLN, anticorps CD50, anticorps ICAM-3, anticorps Icam3, anticorps Tlcn, anticorps ICAM5, anticorps icam5, anticorps tlcn, anticorps tln, anticorps intercellular adhesion molecule 5, anticorps intercellular adhesion molecule 5, telencephalin, anticorps intercellular adhesion molecule 5 L homeolog, anticorps ICAM5, anticorps Icam5, anticorps LOC100511183, anticorps icam5.L

Sujet: ICAM5 is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is expressed on the surface of telencephalic neurons and displays two types of adhesion activity, homophilic binding between neurons and heterophilic binding between neurons and leukocytes.

Poids moléculaire: 95 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, ER-Nucleus Signaling, Maintenance of Protein Location