PCDHGC4 anticorps (N-Term)

N° du produit ABIN634714

Détail du produit anti-PCDHGC4 anticorps

Antigène: PCDHGC4 (Protocadherin gamma Subfamily C, 4 (PCDHGC4))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHGC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDHGC4 antibody was raised against the N terminal of PCDHGC4

Purification: Affinity purified

Immunogène: PCDHGC4 antibody was raised using the N terminal of PCDHGC4 corresponding to a region with amino acids VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHGC4 Blocking Peptide, catalog no. 33R-9627, is also available for use as a blocking control in assays to test for specificity of this PCDHGC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHGC4

Antigène: PCDHGC4 (Protocadherin gamma Subfamily C, 4 (PCDHGC4))

Autre désignation: PCDHGC4 (PCDHGC4 Produits)

Synonymes: anticorps PCDH-GAMMA-C4, anticorps protocadherin gamma c4, anticorps protocadherin gamma subfamily C, 4, anticorps Pcdhgc4, anticorps PCDHGC4

Sujet: PCDHGC4 is a single-pass type I membrane protein. It contains 6 cadherin domains.PCDHGC4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 98 kDa (MW of target protein)