CNTNAP3 anticorps (Middle Region)

N° du produit ABIN634718

Détail du produit anti-CNTNAP3 anticorps

Antigène: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CNTNAP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: CNTNAP3 antibody was raised against the middle region of CNTNAP3

Purification: Affinity purified

Immunogène: CNTNAP3 antibody was raised using the middle region of CNTNAP3 corresponding to a region with amino acids GSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNTNAP3 Blocking Peptide, catalog no. 33R-3563, is also available for use as a blocking control in assays to test for specificity of this CNTNAP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNTNAP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CNTNAP3

Antigène: CNTNAP3 (Contactin Associated Protein-Like 3 (CNTNAP3))

Autre désignation: CNTNAP3 (CNTNAP3 Produits)

Synonymes: anticorps CNTNAP3, anticorps CASPR3, anticorps CNTNAP3A, anticorps RP11-138L21.1, anticorps RP11-290L7.1, anticorps Cntnap3b, anticorps LRRGT00090, anticorps RGD1563615, anticorps Cntnap3, anticorps contactin-associated protein-like 3, anticorps contactin associated protein like 3, anticorps contactin associated protein-like 3, anticorps LOC609770, anticorps CNTNAP3, anticorps LOC100439741, anticorps LOC100473014, anticorps LOC473240, anticorps LOC100345243, anticorps Cntnap3, anticorps LOC100725022

Sujet: The protein encoded by this gene belongs to the NCP family of cell-recognition molecules. This family represents a distinct subgroup of the neurexins. NCP proteins mediate neuron-glial interactions in vertebrates and glial-glial contact in invertebrates.

Poids moléculaire: 141 kDa (MW of target protein)