PCDHGB1 anticorps (N-Term)
-
- Antigène Voir toutes PCDHGB1 Anticorps
- PCDHGB1 (Protocadherin gamma Subfamily B, 1 (PCDHGB1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PCDHGB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCDHGB1 antibody was raised against the N terminal of PCDHGB1
- Purification
- Affinity purified
- Immunogène
- PCDHGB1 antibody was raised using the N terminal of PCDHGB1 corresponding to a region with amino acids SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD
- Top Product
- Discover our top product PCDHGB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCDHGB1 Blocking Peptide, catalog no. 33R-8667, is also available for use as a blocking control in assays to test for specificity of this PCDHGB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHGB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PCDHGB1 (Protocadherin gamma Subfamily B, 1 (PCDHGB1))
- Autre désignation
- PCDHGB1 (PCDHGB1 Produits)
- Synonymes
- anticorps PCDH-GAMMA-B1, anticorps protocadherin gamma subfamily B, 1, anticorps PCDHGB1, anticorps Pcdhgb1
- Sujet
- PCDHGB1 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGB1 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.
- Poids moléculaire
- 85 kDa (MW of target protein)
-