SIGLEC10 anticorps (Middle Region)
-
- Antigène Voir toutes SIGLEC10 Anticorps
- SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SIGLEC10 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SIGLEC10 antibody was raised against the middle region of SIGLEC10
- Purification
- Affinity purified
- Immunogène
- SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL
- Top Product
- Discover our top product SIGLEC10 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SIGLEC10 Blocking Peptide, catalog no. 33R-1714, is also available for use as a blocking control in assays to test for specificity of this SIGLEC10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))
- Autre désignation
- SIGLEC10 (SIGLEC10 Produits)
- Synonymes
- anticorps PRO940, anticorps SIGLEC-10, anticorps SLG2, anticorps Siglecg, anticorps SIGLEC10, anticorps slg2, anticorps pro940, anticorps siglec-10, anticorps sialic acid binding Ig like lectin 10, anticorps sialic acid binding Ig-like lectin 10, anticorps sialic acid-binding Ig-like lectin 10, anticorps SIGLEC10, anticorps Siglec10, anticorps LOC484343, anticorps LOC100066644, anticorps siglec10, anticorps LOC100513863, anticorps LOC100340374
- Sujet
- SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.
- Poids moléculaire
- 76 kDa (MW of target protein)
-