Claudin 7 anticorps (Middle Region)
-
- Antigène Voir toutes Claudin 7 (CLDN7) Anticorps
- Claudin 7 (CLDN7)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Claudin 7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Claudin 7 antibody was raised against the middle region of CLDN7
- Purification
- Affinity purified
- Immunogène
- Claudin 7 antibody was raised using the middle region of CLDN7 corresponding to a region with amino acids GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
- Top Product
- Discover our top product CLDN7 Anticorps primaire
-
anti-Claudin 7 (CLDN7) (Tyr210) antibody
CLDN7 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (AA 172-201), (C-Term) antibodyCLDN7 Reactivité: Humain WB, IHC (p), FACS Hôte: Lapin Polyclonal RB23672 unconjugated
anti-Claudin 7 (CLDN7) antibodyCLDN7 Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (C-Term) antibodyCLDN7 Reactivité: Humain, Souris, Rat WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (AA 29-211) antibodyCLDN7 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (C-Term) antibodyCLDN7 Reactivité: Humain WB, ELISA, IHC, IHC (p), IP Hôte: Souris Monoclonal unconjugated
anti-Claudin 7 (CLDN7) (C-Term) antibodyCLDN7 Reactivité: Humain, Souris, Chien WB, IHC, IHC (p), IF Hôte: Lapin Polyclonal unconjugated
anti-Claudin 7 (CLDN7) (AA 179-209), (C-Term) antibodyCLDN7 Reactivité: Humain WB, IHC (p), FACS, EIA Hôte: Lapin Polyclonal unconjugated
anti-Claudin 7 (CLDN7) antibodyCLDN7 Reactivité: Humain ELISA, IHC Hôte: Souris Monoclonal unconjugated
anti-Claudin 7 (CLDN7) (AA 21-100) antibodyCLDN7 Reactivité: Humain ELISA, IHC (p), IF (cc), IF (p), IHC (fro), ICC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Claudin 7 Blocking Peptide, catalog no. 33R-3466, is also available for use as a blocking control in assays to test for specificity of this Claudin 7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Claudin 7 (CLDN7)
- Autre désignation
- Claudin 7 (CLDN7 Produits)
- Synonymes
- anticorps cb388, anticorps claudin7, anticorps cldn7, anticorps wu:fd19f08, anticorps MGC53400, anticorps MGC75689, anticorps CLDN7, anticorps CEPTRL2, anticorps CLDN-7, anticorps CPETRL2, anticorps Hs.84359, anticorps claudin-1, anticorps claudin 7b, anticorps claudin 7 L homeolog, anticorps claudin 7, anticorps cldn7b, anticorps cldn7.L, anticorps cldn7, anticorps CLDN7, anticorps Cldn7
- Sujet
- Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Hepatitis C
-
