GJD2 anticorps (Middle Region)
-
- Antigène Voir toutes GJD2 Anticorps
- GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GJD2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GJD2 antibody was raised against the middle region of GJD2
- Purification
- Affinity purified
- Immunogène
- GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
- Top Product
- Discover our top product GJD2 Anticorps primaire
-
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 99-197) antibody
GJD2 Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (Middle Region) antibodyGJD2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Lapin, Cobaye, Cheval, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 99-197) antibodyGJD2 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 5E5 unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 201-321) antibodyGJD2 Reactivité: Rat WB, ELISA, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 131-180) antibodyGJD2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Lapin, Cobaye, Cheval, Singe, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (C-Term) antibodyGJD2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Lapin, Cobaye, Cheval, Singe, Porc, Xenopus laevis, Roussette (Chauve-souris), Hamster WB Hôte: Lapin Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 159-208) antibodyGJD2 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Singe WB Hôte: Lapin Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 291-321), (C-Term) antibodyGJD2 Reactivité: Humain, Souris, Rat WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 170-182), (Intracellular) antibodyGJD2 Reactivité: Souris, Rat WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Gap Junction Protein, delta 2, 36kDa (GJD2) (AA 292-321), (C-Term) antibodyGJD2 Reactivité: Humain WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GJD2 Blocking Peptide, catalog no. 33R-2564, is also available for use as a blocking control in assays to test for specificity of this GJD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GJD2 (Gap Junction Protein, delta 2, 36kDa (GJD2))
- Autre désignation
- GJD2 (GJD2 Produits)
- Synonymes
- anticorps CX36, anticorps GJA9, anticorps Cx35.1, anticorps Cx36, anticorps GJD2, anticorps Gja9, anticorps connexin36, anticorps cx36, anticorps gap junction protein delta 2, anticorps gap junction protein, delta 2, anticorps GJD2, anticorps Gjd2
- Sujet
- GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.
- Poids moléculaire
- 36 kDa (MW of target protein)
-
