Neuroligin 4 anticorps (Middle Region)
-
- Antigène Voir toutes Neuroligin 4 (NLGN4) Anticorps
- Neuroligin 4 (NLGN4)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Neuroligin 4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NLGN4 X antibody was raised against the middle region of NLGN4
- Purification
- Affinity purified
- Immunogène
- NLGN4 X antibody was raised using the middle region of NLGN4 corresponding to a region with amino acids ELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFE
- Top Product
- Discover our top product NLGN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NLGN4X Blocking Peptide, catalog no. 33R-2543, is also available for use as a blocking control in assays to test for specificity of this NLGN4X antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NLGN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Neuroligin 4 (NLGN4)
- Autre désignation
- NLGN4X (NLGN4 Produits)
- Synonymes
- anticorps ASPGX2, anticorps AUTSX2, anticorps HLNX, anticorps HNL4X, anticorps NLGN4, anticorps nlgn4, anticorps NLGN4X, anticorps Nlgn4x, anticorps neuroligin 4, X-linked, anticorps neuroligin-4, X-linked, anticorps NLGN4X, anticorps nlgn4x, anticorps LOC100714631
- Sujet
- NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome.
- Poids moléculaire
- 92 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Synaptic Membrane
-