PCDHA10 anticorps (N-Term)

N° du produit ABIN634738

Détail du produit anti-PCDHA10 anticorps

Antigène: PCDHA10 (Protocadherin alpha 10 (PCDHA10))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHA10 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDHA10 antibody was raised against the N terminal of PCDHA10

Purification: Affinity purified

Immunogène: PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHA10 Blocking Peptide, catalog no. 33R-2743, is also available for use as a blocking control in assays to test for specificity of this PCDHA10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHA10

Antigène: PCDHA10 (Protocadherin alpha 10 (PCDHA10))

Autre désignation: PCDHA10 (PCDHA10 Produits)

Synonymes: anticorps CNR8, anticorps CNRN8, anticorps CNRS8, anticorps CRNR8, anticorps PCDH-ALPHA10, anticorps Cnr3, anticorps Cnr8, anticorps Crnr3, anticorps Crnr8, anticorps Pcdha14, anticorps rCNRv10, anticorps protocadherin alpha 10, anticorps PCDHA10, anticorps Pcdha10

Sujet: This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster.

Poids moléculaire: 89 kDa (MW of target protein)