PCDHA5 anticorps (N-Term)

N° du produit ABIN634740

Détail du produit anti-PCDHA5 anticorps

Antigène: PCDHA5 (Protocadherin alpha 5 (PCDHA5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHA5 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDHA5 antibody was raised against the N terminal of PCDHA5

Purification: Affinity purified

Immunogène: PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHA5 Blocking Peptide, catalog no. 33R-9928, is also available for use as a blocking control in assays to test for specificity of this PCDHA5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHA5

Antigène: PCDHA5 (Protocadherin alpha 5 (PCDHA5))

Autre désignation: PCDHA5 (PCDHA5 Produits)

Synonymes: anticorps CNR6, anticorps CNRN6, anticorps CNRS6, anticorps CRNR6, anticorps PCDH-ALPHA5, anticorps Cnr6, anticorps Crnr6, anticorps rCNRv05, anticorps PCDHA5, anticorps Pcdha5, anticorps protocadherin alpha 5, anticorps protocadherin alpha-5, anticorps PCDHA5, anticorps Pcdha5, anticorps LOC100738784, anticorps LOC100847156, anticorps LOC100713870, anticorps LOC100629824

Sujet: The gene encoding PCDHA5 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA5 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA5 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 99 kDa (MW of target protein)