PCDHA6 anticorps (C-Term)

N° du produit ABIN634742

Détail du produit anti-PCDHA6 anticorps

Antigène: PCDHA6 (Protocadherin alpha 6 (PCDHA6))

Épitope: C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCDHA6 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDHA6 antibody was raised against the C terminal of PCDHA6

Purification: Affinity purified

Immunogène: PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDHA6 Blocking Peptide, catalog no. 33R-5518, is also available for use as a blocking control in assays to test for specificity of this PCDHA6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCDHA6

Antigène: PCDHA6 (Protocadherin alpha 6 (PCDHA6))

Autre désignation: PCDHA6 (PCDHA6 Produits)

Sujet: PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Poids moléculaire: 84 kDa (MW of target protein)