Claudin 15 anticorps (Middle Region)
-
- Antigène Voir toutes Claudin 15 (CLDN15) Anticorps
- Claudin 15 (CLDN15)
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Claudin 15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Claudin 15 antibody was raised against the middle region of CLDN15
- Purification
- Affinity purified
- Immunogène
- Claudin 15 antibody was raised using the middle region of CLDN15 corresponding to a region with amino acids LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA
- Top Product
- Discover our top product CLDN15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Claudin 15 Blocking Peptide, catalog no. 33R-5429, is also available for use as a blocking control in assays to test for specificity of this Claudin 15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Claudin 15 (CLDN15)
- Autre désignation
- Claudin 15 (CLDN15 Produits)
- Synonymes
- anticorps CLDN15, anticorps cldn15, anticorps cldn15l, anticorps zgc:63943, anticorps zgc:136755, anticorps 2210009B08Rik, anticorps BB107105, anticorps claudin 15, anticorps claudin 15a, anticorps claudin 15b, anticorps Cldn15, anticorps CLDN15, anticorps cldn15a, anticorps cldn15b
- Sujet
- CLDN15 plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
- Poids moléculaire
- 24 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-