CDH23 anticorps (Middle Region)
-
- Antigène Voir toutes CDH23 Anticorps
- CDH23 (Cadherin 23 (CDH23))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CDH23 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CDH23 antibody was raised against the middle region of CDH23
- Purification
- Affinity purified
- Immunogène
- CDH23 antibody was raised using the middle region of CDH23 corresponding to a region with amino acids DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI
- Top Product
- Discover our top product CDH23 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CDH23 Blocking Peptide, catalog no. 33R-2240, is also available for use as a blocking control in assays to test for specificity of this CDH23 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDH23 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CDH23 (Cadherin 23 (CDH23))
- Autre désignation
- CDH23 (CDH23 Produits)
- Synonymes
- anticorps 4930542A03Rik, anticorps USH1D, anticorps ahl, anticorps ahl1, anticorps bob, anticorps bus, anticorps mdfw, anticorps nmf112, anticorps nmf181, anticorps nmf252, anticorps sals, anticorps v, anticorps CDHR23, anticorps W, anticorps cadherin 23 (otocadherin), anticorps cadherin related 23, anticorps cadherin-related 23, anticorps Cdh23, anticorps CDH23
- Sujet
- This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is thought to be involved in stereocilia organization and hair bundle formation.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-