Protocadherin 8 anticorps (Middle Region)
-
- Antigène Voir toutes Protocadherin 8 (PCDH8) Anticorps
- Protocadherin 8 (PCDH8)
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Protocadherin 8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PCDH8 antibody was raised against the middle region of PCDH8
- Purification
- Affinity purified
- Immunogène
- PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG
- Top Product
- Discover our top product PCDH8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PCDH8 Blocking Peptide, catalog no. 33R-3177, is also available for use as a blocking control in assays to test for specificity of this PCDH8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Protocadherin 8 (PCDH8)
- Autre désignation
- PCDH8 (PCDH8 Produits)
- Synonymes
- anticorps papc, anticorps xpapc, anticorps protocadherin-8, anticorps ARCADLIN, anticorps PAPC, anticorps 1700080P15Rik, anticorps Papc, anticorps Arcadlin, anticorps protocadherin 8, anticorps protocadherin 8 L homeolog, anticorps protocadherin-8, anticorps PCDH8, anticorps pcdh8.L, anticorps LOC485469, anticorps Pcdh8, anticorps LOC100155738
- Sujet
- This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.
- Poids moléculaire
- 101 kDa (MW of target protein)
-