Protocadherin 8 anticorps (Middle Region)

N° du produit ABIN634753

Détail du produit anti-Protocadherin 8 anticorps

Antigène: Protocadherin 8 (PCDH8)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Protocadherin 8 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCDH8 antibody was raised against the middle region of PCDH8

Purification: Affinity purified

Immunogène: PCDH8 antibody was raised using the middle region of PCDH8 corresponding to a region with amino acids GATSLVPEGAARESLVALVSTSDRDSGANGQVRCALYGHEHFRLQPAYAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCDH8 Blocking Peptide, catalog no. 33R-3177, is also available for use as a blocking control in assays to test for specificity of this PCDH8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDH8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Protocadherin 8

Antigène: Protocadherin 8 (PCDH8)

Autre désignation: PCDH8 (PCDH8 Produits)

Sujet: This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. PCDH8 is an integral membrane protein that is thought to function in cell adhesion in a CNS-specific manner. Unlike classical cadherins, which are generally encoded by 15-17 exons, this gene includes only 3 exons. Notable is the large first exon encoding the extracellular region, including 6 cadherin domains and a transmembrane region.

Poids moléculaire: 101 kDa (MW of target protein)