LYVE1 anticorps (N-Term)
-
- Antigène Voir toutes LYVE1 Anticorps
- LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LYVE1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LYVE1 antibody was raised against the N terminal of LYVE1
- Purification
- Affinity purified
- Immunogène
- LYVE1 antibody was raised using the N terminal of LYVE1 corresponding to a region with amino acids ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ
- Top Product
- Discover our top product LYVE1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LYVE1 Blocking Peptide, catalog no. 33R-1461, is also available for use as a blocking control in assays to test for specificity of this LYVE1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYVE1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." dans: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).
: "
-
Identification of lymphatics in the ciliary body of the human eye: a novel "uveolymphatic" outflow pathway." dans: Experimental eye research, Vol. 89, Issue 5, pp. 810-9, (2009) (PubMed).
-
- Antigène
- LYVE1 (Lymphatic Vessel Endothelial Hyaluronan Receptor 1 (LYVE1))
- Autre désignation
- LYVE1 (LYVE1 Produits)
- Synonymes
- anticorps LYVE1, anticorps XLKD1, anticorps CRSBP-1, anticorps HAR, anticorps LYVE-1, anticorps 1200012G08Rik, anticorps Crsbp-1, anticorps Lyve-1, anticorps Xlkd1, anticorps lymphatic vessel endothelial hyaluronic receptor 1a, anticorps lymphatic vessel endothelial hyaluronan receptor 1, anticorps lyve1a, anticorps LYVE1, anticorps Lyve1
- Sujet
- LYVE1 is a type I integral membrane glycoprotein. It acts as a receptor and binds to both soluble and immobilized hyaluronan. This protein may function in lymphatic hyaluronan transport and have a role in tumor metastasis.
- Poids moléculaire
- 35 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-