SIGLEC9 anticorps (C-Term)
-
- Antigène Voir toutes SIGLEC9 Anticorps
- SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SIGLEC9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SIGLEC9 antibody was raised against the C terminal of SIGLEC9
- Purification
- Affinity purified
- Immunogène
- SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA
- Top Product
- Discover our top product SIGLEC9 Anticorps primaire
-
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) (AA 18-348) antibody
SIGLEC9 Reactivité: Humain ELISA, FACS Hôte: Souris Monoclonal 7G4A6 unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) antibodySIGLEC9 Reactivité: Humain WB, ELISA, FACS, ICC, IP Hôte: Souris Monoclonal K8 unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) antibodySIGLEC9 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) (AA 23-142) antibodySIGLEC9 Reactivité: Humain WB, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) antibodySIGLEC9 Reactivité: Humain, Singe, Chien WB, IHC, IF Hôte: Souris Monoclonal 6D8 unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) (AA 385-415), (C-Term) antibodySIGLEC9 Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) (AA 107-134), (N-Term) antibodySIGLEC9 Reactivité: Humain WB Hôte: Lapin Polyclonal RB36251 unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) antibodySIGLEC9 Reactivité: Humain, Souris, Rat IF Hôte: Lapin Polyclonal unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) (AA 1-439) antibodySIGLEC9 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9) (AA 210-340) antibodySIGLEC9 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SIGLEC9 Blocking Peptide, catalog no. 33R-7438, is also available for use as a blocking control in assays to test for specificity of this SIGLEC9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SIGLEC9 (Sialic Acid Binding Ig-Like Lectin 9 (SIGLEC9))
- Autre désignation
- SIGLEC9 (SIGLEC9 Produits)
- Synonymes
- anticorps CD329, anticorps CDw329, anticorps FOAP-9, anticorps OBBP-LIKE, anticorps siglec-9, anticorps siglec9, anticorps sialic acid binding Ig like lectin 9, anticorps sialic acid-binding immunoglobulin-like lectin 9, anticorps SIGLEC9
- Sujet
- SIGLEC9 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. It preferentially binds to alpha2,3- or 2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
- Poids moléculaire
- 50 kDa (MW of target protein)
-
