Claudin 19 anticorps (C-Term)

N° du produit ABIN634757

Détail du produit anti-Claudin 19 anticorps

Antigène: Claudin 19 (CLDN19)

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Claudin 19 est non-conjugé

Application: Western Blotting (WB)

Specificité: Claudin 19 antibody was raised against the C terminal of CLDN19

Purification: Affinity purified

Immunogène: Claudin 19 antibody was raised using the C terminal of CLDN19 corresponding to a region with amino acids AVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Claudin 19 Blocking Peptide, catalog no. 33R-1605, is also available for use as a blocking control in assays to test for specificity of this Claudin 19 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Claudin 19

Antigène: Claudin 19 (CLDN19)

Autre désignation: Claudin 19 (CLDN19 Produits)

Synonymes: anticorps HOMG5, anticorps claudin-19, anticorps zgc:112141, anticorps claudin 19, anticorps claudin 19 S homeolog, anticorps CLDN19, anticorps Cldn19, anticorps cldn19.S, anticorps cldn19

Sujet: CLDN19 belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO).

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C