SIGLEC6 anticorps (C-Term)

N° du produit ABIN634758

Détail du produit anti-SIGLEC6 anticorps

Antigène: SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIGLEC6 est non-conjugé

Application: Western Blotting (WB)

Specificité: SIGLEC6 antibody was raised against the C terminal of SIGLEC6

Purification: Affinity purified

Immunogène: SIGLEC6 antibody was raised using the C terminal of SIGLEC6 corresponding to a region with amino acids IVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIGLEC6 Blocking Peptide, catalog no. 33R-4208, is also available for use as a blocking control in assays to test for specificity of this SIGLEC6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIGLEC6

Antigène: SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Autre désignation: SIGLEC6 (SIGLEC6 Produits)

Synonymes: anticorps SIGLEC6, anticorps CD327, anticorps CD33L, anticorps CD33L1, anticorps CD33L2, anticorps CDW327, anticorps OBBP1, anticorps sialic acid binding Ig like lectin 6, anticorps SIGLEC6

Sujet: SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Poids moléculaire: 47 kDa (MW of target protein)