DGCR2 anticorps (N-Term)
-
- Antigène Voir toutes DGCR2 (DGS2) Anticorps
- DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DGCR2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DGCR2 antibody was raised against the N terminal of DGCR2
- Purification
- Affinity purified
- Immunogène
- DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ
- Top Product
- Discover our top product DGS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DGCR2 Blocking Peptide, catalog no. 33R-6598, is also available for use as a blocking control in assays to test for specificity of this DGCR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DGCR2 (DGS2) (DiGeorge Syndrome Chromosome Region-2 (DGS2))
- Autre désignation
- DGCR2 (DGS2 Produits)
- Synonymes
- anticorps DGS-C, anticorps IDD, anticorps LAN, anticorps SEZ-12, anticorps CIDD, anticorps 9930034O06Rik, anticorps Dgsc, anticorps Idd, anticorps Lan, anticorps Sez12, anticorps mKIAA0163, anticorps zgc:91974, anticorps DiGeorge syndrome critical region gene 2, anticorps DiGeorge syndrome critical region gene 2 S homeolog, anticorps DGCR2, anticorps Dgcr2, anticorps dgcr2, anticorps dgcr2.S
- Sujet
- DGCR2 is the putative adhesion receptor that could be involved in cell-cell or cell-matrix interactions required for normal cell differentiation and migration.
- Poids moléculaire
- 61 kDa (MW of target protein)
-