APP anticorps (Middle Region)
-
- Antigène Voir toutes APP Anticorps
- APP (Amyloid beta (A4) Precursor Protein (APP))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp APP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- APP antibody was raised against the middle region of APP
- Purification
- Affinity purified
- Immunogène
- APP antibody was raised using the middle region of APP corresponding to a region with amino acids RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG
- Top Product
- Discover our top product APP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
APP Blocking Peptide, catalog no. 33R-8067, is also available for use as a blocking control in assays to test for specificity of this APP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- APP (Amyloid beta (A4) Precursor Protein (APP))
- Autre désignation
- APP (APP Produits)
- Synonymes
- anticorps AAA, anticorps ABETA, anticorps ABPP, anticorps AD1, anticorps APPI, anticorps CTFgamma, anticorps CVAP, anticorps PN-II, anticorps PN2, anticorps aaa, anticorps abeta, anticorps abpp, anticorps ad1, anticorps appi, anticorps ctfgamma, anticorps cvap, anticorps pn2, anticorps APP, anticorps APP-like, anticorps APPL, anticorps Abeta, anticorps BcDNA:GH04413, anticorps CG7727, anticorps Dmel\\CG7727, anticorps EG:65F1.5, anticorps appl, anticorps Abpp, anticorps Adap, anticorps Ag, anticorps Cvap, anticorps E030013M08Rik, anticorps betaApp, anticorps app, anticorps wu:fj34d10, anticorps wu:fk65e12, anticorps zgc:85740, anticorps amyloid beta precursor protein, anticorps amyloid beta (A4) precursor protein, anticorps beta amyloid protein precursor-like, anticorps amyloid beta (A4) precursor protein a, anticorps amyloid beta precursor protein L homeolog, anticorps APP, anticorps app, anticorps Appl, anticorps App, anticorps appa, anticorps app.L
- Sujet
- APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
- Poids moléculaire
- 85 kDa (MW of target protein)
- Pathways
- Caspase Cascade in Apoptosis, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour
-